PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_13114_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 336aa    MW: 37014.2 Da    PI: 6.5166
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_13114_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-17158212256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Neem_13114_f_1 158 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 212
                     778899***********************************************98 PP

2HD-ZIP_I/II128.33.2e-41158248192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Neem_13114_f_1 158 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 248
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.1E-526113IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.8E-17141215IPR009057Homeodomain-like
SuperFamilySSF466892.61E-18151215IPR009057Homeodomain-like
PROSITE profilePS5007116.811154214IPR001356Homeobox domain
SMARTSM003893.7E-15156218IPR001356Homeobox domain
CDDcd000862.97E-16158215No hitNo description
PfamPF000464.3E-15158212IPR001356Homeobox domain
PROSITE patternPS000270189212IPR017970Homeobox, conserved site
CDDcd146860.00543207246No hitNo description
SMARTSM003409.1E-26214257IPR003106Leucine zipper, homeobox-associated
PfamPF021835.0E-11214248IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MELGLSLGDT PKPFGFMEKS HEVSSNKGLG FCMGLSIGQS VAEELDLLPN TPVPRNQLAS  60
FLPFPWTSDN GSSEAGSSGQ MVRGFDVNKF PLAEEPEDGA ALSSSPNNSA ASSFQMDFCI  120
YSSGGNKKDI ESGGMGNEIE AERASSRVSD EDENGCTRKK LRLSKEQSAF LEESFKEHNT  180
LNPKQKLALA KQLNLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLHKE  240
LQELRALKTS NPFYMQLPAT TLTMCPSCER VATTTNSNAC GSGAATTTTN ISDPTSTTTG  300
FSLSRPRFFP FSQNQNQQTT SSSSRDQIGK HVEKSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156162TRKKLRL
2206214RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041997.11e-140PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466655e-96HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9HPS01e-139B9HPS0_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02850.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-78homeobox from Arabidopsis thaliana